PDB entry 3qd4

View 3qd4 on RCSB PDB site
Description: Phosphoinositide-Dependent Kinase-1 (PDK1) kinase domain with 1,1-Dimethylethyl{(3R,5R)-1-[2-amino-6-(3-amino-1H-indazol-6-yl)-4-pyrimidinyl]-5-methyl-3-piperidinyl}carbamate
Class: transferase/transferase inhibitor
Keywords: kinase domain, AGC kinase, signal tranduction, ATP & Phosphoinositide, Phosphorylation on S241, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2011-01-17, released 2011-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide-dependent protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PDK1, PDPK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3qd4a_
  • Heterogens: 3Q6, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3qd4A (A:)
    gpamdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsre
    yaikilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngel
    lkyirkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgta
    kvlspeskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfragne
    ylifqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtw
    enlhqqtppklt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3qd4A (A:)
    ppqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtre
    rdvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeiv
    saleylhgkgiihrdlkpenillnedmhiqitdfgtakvlsgtaqyvspellteksacks
    sdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkardlvekllvldat
    krlgceemegygplkahpffesvtwenlhqqtppkl