PDB entry 3qcu

View 3qcu on RCSB PDB site
Description: Crystal structure of the LT3015 antibody Fab fragment in complex with lysophosphatidic acid (14:0)
Class: immune system
Keywords: antibody, lysophosphatidic acid binding, IMMUNE SYSTEM
Deposited on 2011-01-17, released 2011-03-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: LT3015 antibody Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P15220
    Database cross-references and differences (RAF-indexed):
    • PDB 3QCT (0-117)
    • Uniprot Q6N089 (118-222)
  • Chain 'I':
    Compound: LT3015 antibody Fab fragment, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: DKFZp686P15220
    Database cross-references and differences (RAF-indexed):
    • PDB 3QCT (0-117)
    • Uniprot Q6N089 (118-222)
  • Chain 'L':
    Compound: LT3015 antibody Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3QCT (0-112)
    • Uniprot P01834 (113-217)
    Domains in SCOPe 2.04: d3qcul1, d3qcul2
  • Chain 'M':
    Compound: LT3015 antibody Fab fragment, light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 3QCT (0-112)
    • Uniprot P01834 (113-217)
    Domains in SCOPe 2.04: d3qcum1, d3qcum2
  • Heterogens: NKN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qcuL (L:)
    dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3qcuM (M:)
    dvvmtqtplslpvtpgepasisctsgqslvhingntylhwylqkpgqspklliykvsnlf
    sgvpdrfsgsgsgtdftlkisrveaedvgvyfcsqsthfpftfgqgtkleikrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrge