PDB entry 3q8i

View 3q8i on RCSB PDB site
Description: Crystal structure of Anopheles Gambiae odorant binding protein 4 in complex with indole
Class: Odorant Binding Protein
Keywords: Odorant Binding Protein
Deposited on 2011-01-06, released 2011-08-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant binding protein
    Species: Anopheles gambiae [TaxId:7165]
    Gene: AgamOBP4, AGAP010489, agCG48601, OBP-4, OBP4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3q8ia_
  • Heterogens: PO4, IND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3q8iA (A:)
mtmkqltnsmdmmrqacapkfkveeaelhglrksifpanpdkelkcyamciaqmagtmtk
kgeisfsktmaqieamlppemktmakealthckdtqtsykdpcdkayfsakcaadftpdt
fmfp

    Sequence, based on observed residues (ATOM records): (download) 
    >3q8iA (A:)
tmkqltnsmdmmrqacapkfkveeaelhglrksifpanpdkelkcyamciaqmagtmtkk
geisfsktmaqieamlppemktmakealthckdtqtsykdpcdkayfsakcaadftpdtf
mfp