PDB entry 3q6g
View 3q6g on RCSB PDB site
Description: Crystal structure of Fab of rhesus mAb 2.5B specific for quaternary neutralizing epitope of HIV-1 gp120
Class: immune system
Keywords: Ig, neutralization of HIV-1 viruses, Quaternary epitope of HIV-1 gp120, IMMUNE SYSTEM
Deposited on
2010-12-31, released
2011-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-03-20, with a file datestamp of
2013-03-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Heavy chain of Fab of rhesus mAb 2.5B
Species: Macaca mulatta [TaxId:9544]
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: Heavy chain of Fab of rhesus mAb 2.5B
Species: Macaca mulatta [TaxId:9544]
Database cross-references and differences (RAF-indexed):
- Chain 'L':
Compound: Light chain of Fab of rhesus mAb 2.5B
Species: Macaca mulatta [TaxId:9544]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3q6gl1, d3q6gl2 - Chain 'M':
Compound: Light chain of Fab of rhesus mAb 2.5B
Species: Macaca mulatta [TaxId:9544]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3q6gm1, d3q6gm2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
No sequence available.
- Chain 'I':
No sequence available.
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>3q6gL (L:)
ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf
sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlgqpkaapsvtlfp
psseelqankatlvclisdfypgavevawkadgsavnagvettkpskqsnnkyaassyls
ltsdqwkshksyscqvthegstvektvap
- Chain 'M':
Sequence; same for both SEQRES and ATOM records: (download)
>3q6gM (M:)
ydltqarsvsvspgqtarvtcggdnigsksvqwyqqkppqapvlvmsadderssgiperf
sgsnsgntatltisgveagdeadyycqvwdssshhmlfgggtrltvlgqpkaapsvtlfp
psseelqankatlvclisdfypgavevawkadgsavnagvettkpskqsnnkyaassyls
ltsdqwkshksyscqvthegstvektvap