PDB entry 3pyp

View 3pyp on RCSB PDB site
Description: photoactive yellow protein, cryotrapped early light cycle intermediate
Class: photoreceptor
Keywords: photoreceptor, light sensor for negative phototaxis
Deposited on 1998-07-28, released 1999-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: N/A
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Halorhodospira halophila [TaxId:1053]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
  Domains in SCOPe 2.07: d3pypa_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pypA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv