PDB entry 3px8

View 3px8 on RCSB PDB site
Description: RTA in complex with 7-carboxy-pterin
Class: hydrolase/inhibitor
Keywords: Ricin, toxin, protein-ligand complex, hydrolase, ribosome inactivating protein, N-glycosidase, pterin, hydrolase-inhibitor complex
Deposited on 2010-12-09, released 2011-06-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: 0.208
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Preproricin
    Species: Ricinus communis [TaxId:3988]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3px8x_
  • Heterogens: JP2, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3px8X (X:)
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcap