PDB entry 3pal

View 3pal on RCSB PDB site
Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Deposited on 1990-11-08, released 1992-01-15
The last revision prior to the SCOP 1.61 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d3pal__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pal_ (-)
  sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
  elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika