PDB entry 3pal

View 3pal on RCSB PDB site
Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
Class: calcium binding protein
Keywords: calcium binding protein
Deposited on 1990-11-08, released 1992-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.167
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parvalbumin
  Species: Esox lucius [TaxId:8010]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02619 (0-106)
  Domains in SCOPe 2.08: d3pala_
• Heterogens: CA, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3palA (A:)
  sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
  elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika