Lineage for d3pala_ (3pal A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710476Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2710482Protein Parvalbumin [47495] (9 species)
  7. 2710517Species Pike (Esox lucius) [TaxId:8010] [47497] (9 PDB entries)
  8. 2710525Domain d3pala_: 3pal A: [17212]
    complexed with ca, mg

Details for d3pala_

PDB Entry: 3pal (more details), 2.4 Å

PDB Description: ionic interactions with parvalbumins. crystal structure determination of pike 4.10 parvalbumin in four different ionic environments
PDB Compounds: (A:) parvalbumin

SCOPe Domain Sequences for d3pala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pala_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]}
sfaglkdadvaaalaacsaadsfkhkeffakvglaskslddvkkafyvidqdksgfieed
elklflqnfspsaraltdaetkafladgdkdgdgmigvdefaamika

SCOPe Domain Coordinates for d3pala_:

Click to download the PDB-style file with coordinates for d3pala_.
(The format of our PDB-style files is described here.)

Timeline for d3pala_: