PDB entry 3p8g

View 3p8g on RCSB PDB site
Description: Crystal Structure of MT-SP1 in complex with benzamidine
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-10-13, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ST14 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WVC1 (0-240)
      • engineered mutation (157)
    Domains in SCOPe 2.07: d3p8ga_
  • Heterogens: SO4, EDO, BEN, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p8gA (A:)
vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta
flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd
ashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqqitprmmcvgfl
sggvdscqgdsggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg
v