PDB entry 3p7j

View 3p7j on RCSB PDB site
Description: Drosophila HP1a chromo shadow domain
Class: transcription
Keywords: heterochromatin protein 1, chromo shadow domain, gene silencing, epigenetics, TRANSCRIPTION
Deposited on 2010-10-12, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterochromatin protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Su(var)205, HP1, CG8409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7ja_
  • Chain 'B':
    Compound: heterochromatin protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Su(var)205, HP1, CG8409
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7jb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3p7jA (A:)
mkkhhhhhheqdtipvsgstgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssv
anekiprmvihfyeerlswysdnedkk

    Sequence, based on observed residues (ATOM records): (download) 
    >3p7jA (A:)
tgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssvanekiprmvihfyeerls

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3p7jB (B:)
mkkhhhhhheqdtipvsgstgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssv
anekiprmvihfyeerlswysdnedkk

    Sequence, based on observed residues (ATOM records): (download) 
    >3p7jB (B:)
tgfdrgleaekilgasdnngrltfliqfkgvdqaemvpssvanekiprmvihfyeerlsw
y