PDB entry 3p5u

View 3p5u on RCSB PDB site
Description: Actinidin from Actinidia arguta planch (Sarusashi)
Class: Hydrolase
Keywords: SAD, Cysteine proteinases, Hydrolase
Deposited on 2010-10-11, released 2010-11-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.186
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actinidin
    Species: Actinidia arguta [TaxId:64478]
    Database cross-references and differences (RAF-indexed):
    • PDB 3P5U (0-219)
    Domains in SCOPe 2.05: d3p5ua_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p5uA (A:)
lpdyvdwrssgavvdikdqgqcgscwafstiaaveginkiatgdlislseqelvdcgrtq
ntrgcdggfmtdgfqfiinngginteanypytaeegqcnldlqqekyvsidtyenvpynn
ewalqtavayqpvsvaleaagynfqhyssgiftgpcgtavdhavtivgygteggidywiv
knswgttwgeegymriqrnvggvgqcgiakkasypvkyyn