PDB entry 3p57

View 3p57 on RCSB PDB site
Description: Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
Class: transferase/transcription activator/DNA
Keywords: protein-DNA complex, transcription factor, transcriptional activation, p300, zinc finger, TRANSFERASE-TRANSCRIPTION ACTIVATOR-DNA complex
Deposited on 2010-10-08, released 2011-08-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.225
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
• Chain 'B':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
• Chain 'C':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
• Chain 'D':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
• Chain 'E':
  Compound: DNA (5'-d(*a*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*gp*a)-3')
  Species: synthetic, synthetic
  
• Chain 'F':
  Compound: DNA (5'-d(*tp*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*tp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'G':
  Compound: DNA (5'-d(*a*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*gp*a)-3')
  Species: synthetic, synthetic
  
• Chain 'H':
  Compound: DNA (5'-d(*tp*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*tp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'I':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
• Chain 'J':
  Compound: myocyte-specific enhancer factor 2a
  Species: Homo sapiens [TaxId:9606]
  Gene: MEF2, MEF2A
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02078 (0-89)
  Domains in SCOPe 2.02: d3p57j_
• Chain 'K':
  Compound: DNA (5'-d(*a*ap*ap*cp*tp*ap*tp*tp*tp*ap*tp*ap*ap*gp*a)-3')
  Species: synthetic, synthetic
  
• Chain 'L':
  Compound: DNA (5'-d(*tp*tp*cp*tp*tp*ap*tp*ap*ap*ap*tp*ap*gp*tp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'P':
  Compound: Histone acetyltransferase p300
  Species: Homo sapiens [TaxId:9606]
  Gene: EP300, P300
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q09472 (2-111)
    • expression tag (0-1)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p57J (J:)
  grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
  mdkvllkyteynephesrtnsdivealnkk
  

  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.