PDB entry 3p1p

View 3p1p on RCSB PDB site
Description: Crystal structure of human 14-3-3 sigma C38N/N166H in complex with TASK-3 peptide
Class: peptide binding protein
Keywords: Helical protein, Phosphoprotein, Adapter protein, Peptide binding protein, Nucleus
Deposited on 2010-09-30, released 2011-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
      • engineered mutation (42)
      • engineered mutation (170)
    Domains in SCOPe 2.02: d3p1pa_
  • Chain 'P':
    Compound: 6-mer peptide from Potassium channel subfamily K member 9
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p1pA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsneernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkemppthpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'P':
    No sequence available.