PDB entry 3oxk

View 3oxk on RCSB PDB site
Description: Crystal structure of a histidine triad family protein from Entamoeba histolytica, bound to GMP
Class: metal binding protein
Keywords: SSGCID, NIH, NIAID, SBRI, UW, Emerald BioStructures, putative hydrolase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, METAL BINDING PROTEIN
Deposited on 2010-09-21, released 2010-10-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.159
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative histidine triad family protein
    Species: Entamoeba histolytica [TaxId:294381]
    Gene: EHI_093910
    Database cross-references and differences (RAF-indexed):
    • Uniprot C4LYI2 (4-116)
      • expression tag (2-3)
    Domains in SCOPe 2.04: d3oxka_
  • Heterogens: ZN, 5GP, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3oxkA (A:)
gpgsmadscifckiaqkqipstivyeddeifafkdinpiapihilvipkqhiaslneite
eneafigkvlykvsligkkecpegyrvvnnigedagqtvkhihfhilggkklawdkl

    Sequence, based on observed residues (ATOM records): (download) 
    >3oxkA (A:)
gsmadscifckiaqkqipstivyeddeifafkdinpiapihilvipkqhiaslneiteen
eafigkvlykvsligkkecpegyrvvnnigedagqtvkhihfhilggkklawdkl