PDB entry 3oud

View 3oud on RCSB PDB site
Description: MDR769 HIV-1 protease complexed with CA/p2 hepta-peptide
Class: hydrolase/peptide
Keywords: MDR HIV-1 protease, inhibitor, drug resistance, substrate envelope, HIV-1 protease, protease, CA/p2 substrate peptide, none, HYDROLASE, HYDROLASE-PEPTIDE complex
Deposited on 2010-09-14, released 2011-03-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: MDR HIV-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.02: d3ouda_
• Chain 'B':
  Compound: MDR HIV-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q000H7 (0-98)
    • conflict (24)
    • conflict (31)
    • conflict (34-35)
    • conflict (45)
  Domains in SCOPe 2.02: d3oudb_
• Chain 'P':
  Compound: CA/p2 substrate peptide
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • PDB 3OUD (0-6)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oudA (A:)
  pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3oudB (B:)
  pqitlwqrpivtikiggqlkeallntgaddttleevnlpgrwkpkliggiggfvkvrqyd
  qvpieicghkvigtvlvgptptnvigrnlmtqigctlnf
  

  
  
• Chain 'P':
  No sequence available.