PDB entry 3oob

View 3oob on RCSB PDB site
Description: Structural and functional insights of directly targeting Pin1 by Epigallocatechin-3-gallate
Class: isomerase
Keywords: WW domain-like peptidyl prolyl isomerase, phosphorylation-dependent cis/trans isomerase, proteins with pSer/pThr-Pro motif, ISOMERASE
Deposited on 2010-08-30, released 2011-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-162)
      • engineered mutation (13)
    Domains in SCOPe 2.04: d3ooba1, d3ooba2
  • Heterogens: SO4, PE4, KDH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oobA (A:)
    madeeklppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshl
    lvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakarg
    dlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oobA (A:)
    klppgwekamsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqek
    itrtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfeda
    sfalrtgemsgpvftdsgihiilrte