PDB entry 3ona

View 3ona on RCSB PDB site
Description: The SECRET domain in complex with CX3CL1
Class: viral protein/cytokine
Keywords: beta-sandwich, chemokine fold, vTNFR-chemokine complex, VIRAL PROTEIN-CYTOKINE complex
Deposited on 2010-08-28, released 2011-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.199
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumour necrosis factor receptor
    Species: Ectromelia virus [TaxId:12643]
    Gene: crmD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7TDW8 (4-End)
      • expression tag (3)
  • Chain 'B':
    Compound: CX3CL1 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3onab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3onaB (B:)
    gamgqhhgvtkcnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeq
    wvkdamqhldrqaaaltrng
    

    Sequence, based on observed residues (ATOM records): (download)
    >3onaB (B:)
    cnitcskmtskipvallihyqqnqascgkraiiletrqhrlfcadpkeqwvkdamqhldr
    qaaalt