PDB entry 3ok5

View 3ok5 on RCSB PDB site
Description: Structure of the H55D mutant of dehaloperoxidase-hemoglobin A from Amphitriti ornata with 4-Bromophenol inhibitor
Class: oxidoreductase
Keywords: globin, peroxidase, dehaloperoxidase, OXIDOREDUCTASE
Deposited on 2010-08-24, released 2011-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-14, with a file datestamp of 2011-09-09.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.244
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (54)
    Domains in SCOPe 2.04: d3ok5a_
  • Chain 'B':
    Compound: Dehaloperoxidase A
    Species: Amphitrite ornata [TaxId:129555]
    Gene: dhpA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NAV8 (0-136)
      • engineered mutation (54)
    Domains in SCOPe 2.04: d3ok5b_
  • Heterogens: HEM, BML, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ok5A (A:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ok5B (B:)
    gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgddtekvf
    nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
    drfgknlvsalssagmk