PDB entry 3og8

View 3og8 on RCSB PDB site
Description: Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA
Class: hydrolase/RNA
Keywords: Innate immunity, viral RNA sensing, RNA binding domain, IPS-1, cytosolic, HYDROLASE-RNA complex
Deposited on 2010-08-16, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-23, with a file datestamp of 2011-03-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent RNA helicase DDX58
  Species: Homo sapiens [TaxId:9606]
  Gene: DDX58
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95786 (Start-124)
    • engineered mutation (28)
    • expression tag (125-127)
  Domains in SCOPe 2.08: d3og8a1, d3og8a2
• Chain 'B':
  Compound: ATP-dependent RNA helicase DDX58
  Species: Homo sapiens [TaxId:9606]
  Gene: DDX58
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95786 (1-124)
    • expression tag (0)
    • engineered mutation (28)
    • expression tag (125-127)
  Domains in SCOPe 2.08: d3og8b1, d3og8b2, d3og8b3
• Chain 'C':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  
• Chain 'D':
  Compound: RNA (5'-r(*gp*gp*cp*gp*cp*gp*cp*gp*cp*gp*cp*gp*cp*c)-3')
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3og8A (A:)
  mdkenkkllcrkckalacytadvrvieeshytvlgdafkecfvsrphpkpkqfssfekra
  kifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdp
  aemskleh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3og8A (A:)
  kenkkllcrkckalacytadvrvieeshytvlgdafkecfvsrphpkpkqfssfekraki
  fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
  mskleh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3og8B (B:)
  mdkenkkllcrkckalacytadvrvieeshytvlgdafkecfvsrphpkpkqfssfekra
  kifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdp
  aemskleh
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.