Lineage for d3og8a1 (3og8 A:803-925)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818988Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families) (S)
    Pfam PF11648
  5. 2818989Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)
  6. 2818996Protein RIG-I C-terminal domain [254412] (1 species)
  7. 2818997Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)
  8. 2819000Domain d3og8a1: 3og8 A:803-925 [248251]
    Other proteins in same PDB: d3og8a2, d3og8b2, d3og8b3
    automated match to d2qfba_
    protein/RNA complex; complexed with zn

Details for d3og8a1

PDB Entry: 3og8 (more details), 2.4 Å

PDB Description: Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA
PDB Compounds: (A:) ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d3og8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3og8a1 b.88.2.1 (A:803-925) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
kenkkllcrkckalacytadvrvieeshytvlgdafkecfvsrphpkpkqfssfekraki
fcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpae
msk

SCOPe Domain Coordinates for d3og8a1:

Click to download the PDB-style file with coordinates for d3og8a1.
(The format of our PDB-style files is described here.)

Timeline for d3og8a1: