PDB entry 3of1

View 3of1 on RCSB PDB site
Description: Crystal Structure of Bcy1, the Yeast Regulatory Subunit of PKA
Class: transferase
Keywords: Cyclic nucleotide binding domain, Evolution, PKA signaling, Regulatory subunit, cAMP-dependent protein kinase, TRANSFERASE
Deposited on 2010-08-13, released 2010-12-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-12-01, with a file datestamp of 2010-11-26.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase regulatory subunit
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: BCY1, REG1, SRA1, YIL033C
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07278 (0-245)
  Domains in SCOPe 2.04: d3of1a1, d3of1a2
• Heterogens: CMP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3of1A (A:)
  qlqrleksirnnflfnkldsdskrlvincleeksvpkgatiikqgdqgdyfyvvekgtvd
  fyvndnkvnssgpgssfgelalmynspraatvvatsdcllwaldrltfrkillgssfkkr
  lmyddllksmpvlkslttydrakladaldtkiyqpgetiiregdqgenfylieygavdvs
  kkgqgvinklkdhdyfgevallndlprqatvtatkrtkvatlgksgfqrllgpavdvlkl
  ndptrh