PDB entry 3oeq

View 3oeq on RCSB PDB site
Description: Crystal structure of trimeric frataxin from the yeast Saccharomyces cerevisiae, with full length n-terminus
Class: transport protein
Keywords: alpha/beta sandwich, metallochaperone, iron-storage, transport protein
Deposited on 2010-08-13, released 2011-08-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.268
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frataxin homolog, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YFH1, YDL120W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07540 (0-End)
      • engineered mutation (21)
    Domains in SCOPe 2.01: d3oeqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3oeqA (A:)
vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl
eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
ksq

    Sequence, based on observed residues (ATOM records): (download) 
    >3oeqA (A:)
vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl
eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
k