Lineage for d3oeqa_ (3oeq A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033660Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1033687Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families) (S)
  5. 1033688Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
  6. 1033702Protein automated matches [191244] (2 species)
    not a true protein
  7. 1033703Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [190012] (1 PDB entry)
  8. 1033704Domain d3oeqa_: 3oeq A: [182968]
    automated match to d2ga5a1

Details for d3oeqa_

PDB Entry: 3oeq (more details), 2.96 Å

PDB Description: crystal structure of trimeric frataxin from the yeast saccharomyces cerevisiae, with full length n-terminus
PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d3oeqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeqa_ d.82.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl
eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
k

SCOPe Domain Coordinates for d3oeqa_:

Click to download the PDB-style file with coordinates for d3oeqa_.
(The format of our PDB-style files is described here.)

Timeline for d3oeqa_: