Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (2 families) |
Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins |
Protein automated matches [191244] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [190012] (1 PDB entry) |
Domain d3oeqa_: 3oeq A: [182968] automated match to d2ga5a1 |
PDB Entry: 3oeq (more details), 2.96 Å
SCOPe Domain Sequences for d3oeqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeqa_ d.82.2.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais k
Timeline for d3oeqa_: