PDB entry 3o79

View 3o79 on RCSB PDB site
Description: Crystal Structure of Wild-type Rabbit PrP 126-230
Class: membrane protein
Keywords: prp, prion, MEMBRANE PROTEIN
Deposited on 2010-07-30, released 2010-11-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.161
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rabbit PrP
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3o79a_
  • Chain 'B':
    Compound: Rabbit PrP
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: PRNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3o79b_
  • Heterogens: NA, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3o79A (A:)
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa

    Sequence, based on observed residues (ATOM records): (download) 
    >3o79A (A:)
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqes

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3o79B (B:)
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnsfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesqaayqraa