PDB entry 3o2h
View 3o2h on RCSB PDB site
Description: E. coli ClpS in complex with a Leu N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, N-end rule peptide, PEPTIDE BINDING PROTEIN
Deposited on
2010-07-22, released
2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated
2012-04-25, with a file datestamp of
2012-04-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ATP-dependent Clp protease adaptor protein clpS
Species: Escherichia coli [TaxId:83333]
Gene: clpS
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3o2ha_ - Chain 'B':
Compound: DNA protection during starvation protein
Species: Escherichia coli, synthetic [TaxId:83333]
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3o2hA (A:)
gktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratql
mlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
Sequence, based on observed residues (ATOM records): (download)
>3o2hA (A:)
qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
icgvftaevaetkvamvnkyarenehpllctleka
- Chain 'B':
No sequence available.