PDB entry 3o2h

View 3o2h on RCSB PDB site
Description: E. coli ClpS in complex with a Leu N-end rule peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, N-end rule peptide, PEPTIDE BINDING PROTEIN
Deposited on 2010-07-22, released 2011-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent Clp protease adaptor protein clpS
  Species: Escherichia coli [TaxId:83333]
  Gene: clpS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A8Q6 (Start-104)
  Domains in SCOPe 2.06: d3o2ha_
• Chain 'B':
  Compound: DNA protection during starvation protein
  Species: Escherichia coli, synthetic [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABT2 (0-10)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3o2hA (A:)
  gktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratql
  mlavhyqgkaicgvftaevaetkvamvnkyarenehpllctleka
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3o2hA (A:)
  qlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgka
  icgvftaevaetkvamvnkyarenehpllctleka
  

  
  
• Chain 'B':
  No sequence available.