PDB entry 3o1f

View 3o1f on RCSB PDB site
Description: P1 crystal form of E. coli ClpS at 1.4 A resolution
Class: hydrolase
Keywords: adaptor, HYDROLASE
Deposited on 2010-07-21, released 2011-07-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent Clp protease adapter protein clpS
  Species: Escherichia coli [TaxId:562]
  Gene: clpS
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3QP81 (0-80)
  Domains in SCOPe 2.04: d3o1fa_
• Chain 'B':
  Compound: ATP-dependent Clp protease adapter protein clpS
  Species: Escherichia coli [TaxId:562]
  Gene: clpS
  Database cross-references and differences (RAF-indexed):
  • Uniprot D3QP81 (0-80)
  Domains in SCOPe 2.04: d3o1fb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3o1fA (A:)
  smykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaevaetkv
  amvnkyarenehpllctleka
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3o1fB (B:)
  smykvilvnddytpmefvidvlqkffsydveratqlmlavhyqgkaicgvftaevaetkv
  amvnkyarenehpllctleka