PDB entry 3nx9

View 3nx9 on RCSB PDB site
Description: Crystal structure of type I ribosome inactivating protein in complex with maltose at 1.7A resolution
Class: Hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, maltose, Hydrolase
Deposited on 2010-07-13, released 2010-08-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NX9 (0-245)
    Domains in SCOPe 2.04: d3nx9a_
  • Heterogens: MAL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nx9A (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni