PDB entry 3nqu

View 3nqu on RCSB PDB site
Description: Crystal structure of partially trypsinized (CENP-A/H4)2 heterotetramer
Class: DNA binding protein
Keywords: alpha helix, histone fold, centromere, DNA BINDING PROTEIN
Deposited on 2010-06-29, released 2010-08-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.239
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3-like centromeric protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone h4
    Species: Homo sapiens [TaxId:9606]
    Gene: HIST1H4A, H4/A, H4FA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3nqub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nquB (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nquB (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalk