PDB entry 3nq3

View 3nq3 on RCSB PDB site
Description: Bovine beta-lactoglobulin complex with capric acid
Class: transport protein
Keywords: beta-lactoglobulin, lipocalin, bovine milk, capric acid, decanoic acid, fatty acid, TRANSPORT PROTEIN
Deposited on 2010-06-29, released 2010-07-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.241
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactoglobulin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nq3a_
  • Heterogens: DKA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nq3A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi