PDB entry 3no3

View 3no3 on RCSB PDB site
Description: Crystal structure of a glycerophosphodiester phosphodiesterase (BDI_0402) from Parabacteroides distasonis ATCC 8503 at 1.89 A resolution
Class: hydrolase
Keywords: Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, HYDROLASE
Deposited on 2010-06-24, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.151
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerophosphodiester phosphodiesterase
    Species: Parabacteroides distasonis [TaxId:435591]
    Gene: BDI_0402
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6L916 (1-237)
      • leader sequence (0)
    Domains in SCOPe 2.07: d3no3a1, d3no3a2
  • Heterogens: MG, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3no3A (A:)
    gkdntkviahrgywktegsaqnsirsleraseigaygsefdvhltadnvlvvyhdndiqg
    khiqsctydelkdlqlsngeklptleqylkrakklknirlifelkshdtpernrdaarls
    vqmvkrmklakrtdyisfnmdackefirlcpksevsylngelspmelkelgftgldyhyk
    vlqshpdwvkdckvlgmtsnvwtvddpklmeemidmgvdfittdlpeetqkilhsraq