SCOPe 2.08: Domain d3no3a1: 3no3 A:22-258

Lineage for d3no3a1 (3no3 A:22-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Parabacteroides distasonis [TaxId:435591] [189422] (1 PDB entry)

8. Domain d3no3a1: 3no3 A:22-258 [182433]
   Other proteins in same PDB: d3no3a2
   automated match to d1o1za_
   complexed with gol, mg, peg

Details for d3no3a1

PDB Entry: 3no3, 1.89 Å

PDB Description: Crystal structure of a glycerophosphodiester phosphodiesterase (BDI_0402) from Parabacteroides distasonis ATCC 8503 at 1.89 A resolution

PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d3no3a1:

Sequence; same for both SEQRES and ATOM records:

>d3no3a1 c.1.18.0 (A:22-258) automated matches {Parabacteroides distasonis [TaxId: 435591]}
kdntkviahrgywktegsaqnsirsleraseigaygsefdvhltadnvlvvyhdndiqgk
hiqsctydelkdlqlsngeklptleqylkrakklknirlifelkshdtpernrdaarlsv
qmvkrmklakrtdyisfnmdackefirlcpksevsylngelspmelkelgftgldyhykv
lqshpdwvkdckvlgmtsnvwtvddpklmeemidmgvdfittdlpeetqkilhsraq

Timeline for d3no3a1:

• d3no3a1 first appeared in SCOPe 2.01, called d3no3a_
  
• d3no3a1 appears in SCOPe 2.07