Lineage for d3no3a1 (3no3 A:22-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839880Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2839967Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2839968Protein automated matches [190919] (11 species)
    not a true protein
  7. 2839987Species Parabacteroides distasonis [TaxId:435591] [189422] (1 PDB entry)
  8. 2839988Domain d3no3a1: 3no3 A:22-258 [182433]
    Other proteins in same PDB: d3no3a2
    automated match to d1o1za_
    complexed with gol, mg, peg

Details for d3no3a1

PDB Entry: 3no3 (more details), 1.89 Å

PDB Description: Crystal structure of a glycerophosphodiester phosphodiesterase (BDI_0402) from Parabacteroides distasonis ATCC 8503 at 1.89 A resolution
PDB Compounds: (A:) glycerophosphodiester phosphodiesterase

SCOPe Domain Sequences for d3no3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3no3a1 c.1.18.0 (A:22-258) automated matches {Parabacteroides distasonis [TaxId: 435591]}
kdntkviahrgywktegsaqnsirsleraseigaygsefdvhltadnvlvvyhdndiqgk
hiqsctydelkdlqlsngeklptleqylkrakklknirlifelkshdtpernrdaarlsv
qmvkrmklakrtdyisfnmdackefirlcpksevsylngelspmelkelgftgldyhykv
lqshpdwvkdckvlgmtsnvwtvddpklmeemidmgvdfittdlpeetqkilhsraq

SCOPe Domain Coordinates for d3no3a1:

Click to download the PDB-style file with coordinates for d3no3a1.
(The format of our PDB-style files is described here.)

Timeline for d3no3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3no3a2