PDB entry 3nfk

View 3nfk on RCSB PDB site
Description: Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies virus G protein
Class: protein binding
Keywords: PDZ-PDZ-binding site complex, PROTEIN BINDING
Deposited on 2010-06-10, released 2011-08-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.193
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3nfka_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3nfkb_
  • Chain 'C':
    Compound: Glycoprotein G
    Species: Rabies virus, synthetic [TaxId:11292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Glycoprotein G
    Species: Rabies virus, synthetic [TaxId:11292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nfkA (A:)
gsspekptpnggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcv
prlnegdqvvlingrdiaehthdqvvlfikascerhsgelmllvrpn

    Sequence, based on observed residues (ATOM records): (download) 
    >3nfkA (A:)
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascerhsgelmllvrpn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3nfkB (B:)
gsspekptpnggiphdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcv
prlnegdqvvlingrdiaehthdqvvlfikascerhsgelmllvrpn

    Sequence, based on observed residues (ATOM records): (download) 
    >3nfkB (B:)
hdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvling
rdiaehthdqvvlfikascesgelmllvrpn

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.