PDB entry 3ne7

View 3ne7 on RCSB PDB site
Description: Crystal structure of paia n-acetyltransferase from thermoplasma acidophilum in complex with coenzyme a
Class: transferase
Keywords: COENZYME A, STRUCTURAL GENOMICS, MCSG, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, TRANSFERASE
Deposited on 2010-06-08, released 2010-07-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.187
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyltransferase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0374
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ne7a_
  • Heterogens: NI, COA, BME, SO4, GOL, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ne7A (A:)
    msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn
    ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi
    lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky