PDB entry 3nc0

View 3nc0 on RCSB PDB site
Description: Crystal structure of the HIV-1 Rev NES-CRM1-RanGTP nuclear export complex (crystal II)
Class: GTP-binding protein/transport protein
Keywords: protein transport, GTP-binding protein-transport protein complex
Deposited on 2010-06-04, released 2010-10-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.245
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Crm1, Xpo1, Xpo1 (GeneID: 103573)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNUPN (GeneID: 10073), RNUT1, SNUPN, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (16-361)
      • expression tag (4-15)
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN, RAN (GeneID: 5901)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-175)
      • engineered (64)
    Domains in SCOPe 2.08: d3nc0c_
  • Chain 'D':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Crm1, Xpo1, Xpo1 (GeneID: 103573)
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNUPN (GeneID: 10073), RNUT1, SNUPN, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (16-361)
      • expression tag (4-15)
  • Chain 'F':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN, RAN (GeneID: 5901)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-175)
      • engineered (64)
    Domains in SCOPe 2.08: d3nc0f_
  • Heterogens: GOL, PEG, IPH, GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nc0C (C:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nc0C (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nc0F (F:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nc0F (F:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp