SCOPe 2.08: Domain d3nc0c_: 3nc0 C:

Lineage for d3nc0c_ (3nc0 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d3nc0c_: 3nc0 C: [213875]
   automated match to d3ea5a_
   complexed with gol, gtp, iph, mg, peg

Details for d3nc0c_

PDB Entry: 3nc0, 2.9 Å

PDB Description: crystal structure of the hiv-1 rev nes-crm1-rangtp nuclear export complex (crystal ii)

PDB Compounds: (C:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3nc0c_:

Sequence; same for both SEQRES and ATOM records:

>d3nc0c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp

Timeline for d3nc0c_:

• d3nc0c_ first appeared in SCOPe 2.03
  
• d3nc0c_ appears in SCOPe 2.07