PDB entry 3na0
View 3na0 on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with 20,22-dihydroxycholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, 20,22-dihydroxycholesterol, side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on
2010-05-31, released
2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: CYP11A, CYP11A1
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: CYP11A, CYP11A1
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Adrenodoxin, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: adrenodoxin, ADX, FDX1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3na0c_ - Chain 'D':
Compound: Adrenodoxin, mitochondrial
Species: Homo sapiens [TaxId:9606]
Gene: adrenodoxin, ADX, FDX1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d3na0d_ - Heterogens: HEM, 2DC, FES, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>3na0C (C:)
slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
srlgcqic
Sequence, based on observed residues (ATOM records): (download)
>3na0C (C:)
fgacegtlacstctdeendmldlalgcq
- Chain 'D':
Sequence, based on SEQRES records: (download)
>3na0D (D:)
slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
srlgcqic
Sequence, based on observed residues (ATOM records): (download)
>3na0D (D:)
fgacegtlacstctdeendmldlalgcq