PDB entry 3na0

View 3na0 on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with 20,22-dihydroxycholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, 20,22-dihydroxycholesterol, side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on 2010-05-31, released 2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cholesterol side-chain cleavage enzyme, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP11A, CYP11A1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3na0c_
  • Chain 'D':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: adrenodoxin, ADX, FDX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3na0d_
  • Heterogens: HEM, 2DC, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3na0C (C:)
    slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
    srlgcqic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na0C (C:)
    fgacegtlacstctdeendmldlalgcq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3na0D (D:)
    slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
    srlgcqic
    

    Sequence, based on observed residues (ATOM records): (download)
    >3na0D (D:)
    fgacegtlacstctdeendmldlalgcq