PDB entry 3n9z

View 3n9z on RCSB PDB site
Description: Crystal structure of human CYP11A1 in complex with 22-hydroxycholesterol
Class: Oxidoreductase, Electron transport
Keywords: cytochrome P450, 22-hydroxycholesterol, cholesterol side chain cleavage, Structural Genomics, Structural Genomics Consortium, SGC, Oxidoreductase, Electron transport
Deposited on 2010-05-31, released 2011-06-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.211
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cholesterol side-chain cleavage enzyme
  Species: Homo sapiens [TaxId:9606]
  Gene: CYP11A, CYP11A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05108
• Chain 'B':
  Compound: Cholesterol side-chain cleavage enzyme
  Species: Homo sapiens [TaxId:9606]
  Gene: CYP11A, CYP11A1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05108
• Chain 'C':
  Compound: adrenodoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: adrenodoxin, ADX, FDX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10109
  Domains in SCOPe 2.02: d3n9zc_
• Chain 'D':
  Compound: adrenodoxin
  Species: Homo sapiens [TaxId:9606]
  Gene: adrenodoxin, ADX, FDX1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10109
  Domains in SCOPe 2.02: d3n9zd_
• Heterogens: HEM, HC9, FES, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3n9zC (C:)
  ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
  hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
  kts
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3n9zC (C:)
  gacegtlacstchldeendmldlrlgc
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3n9zD (D:)
  ssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifed
  hiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvg
  kts
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3n9zD (D:)
  gacegtlacstchldeendmldlrlgc