PDB entry 3n8h

View 3n8h on RCSB PDB site
Description: Crystal Structure of Pantoate-beta-alanine Ligase from Francisella tularensis
Class: ligase
Keywords: alpha-beta sandwich, Ligase, Structural Genomics, structural genomics of infectious diseases, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2010-05-28, released 2010-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate synthetase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_1390, panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NF57 (3-263)
      • expression tag (2)
    Domains in SCOPe 2.07: d3n8ha1, d3n8ha2
  • Chain 'B':
    Compound: Pantothenate synthetase
    Species: Francisella tularensis subsp. tularensis [TaxId:177416]
    Gene: FTT_1390, panC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NF57 (3-263)
      • expression tag (2)
    Domains in SCOPe 2.07: d3n8hb1, d3n8hb2
  • Heterogens: PRO, AMP, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n8hA (A:)
    snamiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvn
    ptqfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianile
    gksrpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqr
    qpsglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnr
    iflafyigkvrlidnflketgpsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8hA (A:)
    amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
    qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
    srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
    sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
    lafyigkvrlidnflketgpsc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n8hB (B:)
    snamiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvn
    ptqfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianile
    gksrpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqr
    qpsglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnr
    iflafyigkvrlidnflketgpsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n8hB (B:)
    amiiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnpt
    qfnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegk
    srpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqp
    sglplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrif
    lafyigkvrlidnflketgpsc