Lineage for d3n8ha1 (3n8h A:1-261)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860944Species Francisella tularensis [TaxId:177416] [196438] (3 PDB entries)
  8. 2860945Domain d3n8ha1: 3n8h A:1-261 [199939]
    Other proteins in same PDB: d3n8ha2, d3n8hb2
    automated match to d3n8hb_
    complexed with acy, amp, gol, pro

Details for d3n8ha1

PDB Entry: 3n8h (more details), 2 Å

PDB Description: crystal structure of pantoate-beta-alanine ligase from francisella tularensis
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3n8ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8ha1 c.26.1.0 (A:1-261) automated matches {Francisella tularensis [TaxId: 177416]}
miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptq
fnnpndyqtypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegks
rpghfsgmltvvlkllqitkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqps
glplssrnknltstdieiankiyeilrqddfsnleeltnkinstgaklqyiqklnnrifl
afyigkvrlidnflketgpsc

SCOPe Domain Coordinates for d3n8ha1:

Click to download the PDB-style file with coordinates for d3n8ha1.
(The format of our PDB-style files is described here.)

Timeline for d3n8ha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n8ha2