PDB entry 3n3x

View 3n3x on RCSB PDB site
Description: Crystal Structure of the complex formed between type I ribosome inactivating protein and hexapeptide Ser-Asp-Asp-Asp-Met-Gly at 1.7 A resolution
Class: Hydrolase
Keywords: RIP, Plant protein, Ribosome inactivating protein, hexapeptide, Hydrolase
Deposited on 2010-05-20, released 2010-06-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.21
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N3X (0-245)
    Domains in SCOPe 2.06: d3n3xa_
  • Chain 'B':
    Compound: SDDDMG peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3N3X (0-5)
  • Heterogens: GUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3n3xA (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

  • Chain 'B':
    No sequence available.