PDB entry 3n31

View 3n31 on RCSB PDB site
Description: Crystal Structure of the complex of type I ribosome inactivating protein with fucose at 2.1A resolution
Class: Hydrolase
Keywords: RIP, RNA N-glycosidase, Plant protein, fucose, Hydrolase
Deposited on 2010-05-19, released 2010-06-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-06-30, with a file datestamp of 2010-06-25.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.176
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N31 (0-245)
    Domains in SCOPe 2.04: d3n31a_
  • Heterogens: FCA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3n31A (A:)
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni