PDB entry 3n2v

View 3n2v on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with the inhibitor N-hydroxy-2-(N-hydroxyethyl)biphenyl-4-ylsulfonamido)acetamide
Class: Hydrolase/Hydrolase inhibitor
Keywords: MATRIX METALLOPROTEINASE, MMP12, ELASTASE, COMPLEX (ELASTASE-INHIBITOR), METALLO ELASTASE, EXTRACELLULAR MATRIX, GLYCOPROTEIN, HYDROLASE, METAL-INDING, METALLOPROTEASE, PROTEASE, SECRETED, ZYMOGEN, Hydrolase-Hydrolase inhibitor complex
Deposited on 2010-05-19, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-157)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d3n2va_
  • Heterogens: ZN, CA, JT5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n2vA (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg