Lineage for d3n2va_ (3n2v A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964444Domain d3n2va_: 3n2v A: [181854]
    automated match to d1os2a_
    complexed with ca, jt5, zn

Details for d3n2va_

PDB Entry: 3n2v (more details), 1.55 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(n-hydroxyethyl)biphenyl-4- ylsulfonamido)acetamide
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3n2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2va_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3n2va_:

Click to download the PDB-style file with coordinates for d3n2va_.
(The format of our PDB-style files is described here.)

Timeline for d3n2va_: