PDB entry 3n1n

View 3n1n on RCSB PDB site
Description: Crystal structure of the complex of type I ribosome inactivating protein with guanine at 2.2A resolution
Class: Hydrolase
Keywords: RIP, Hydrolase
Deposited on 2010-05-16, released 2010-07-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.173
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome inactivating protein
    Species: Momordica balsamina [TaxId:3672]
    Database cross-references and differences (RAF-indexed):
    • PDB 3N1N (0-245)
    Domains in SCOPe 2.04: d3n1na_
  • Heterogens: GUN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3n1nA (A:)
    dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
    tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
    prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
    lntkni