PDB entry 3mzh

View 3mzh on RCSB PDB site
Description: Crystal structure of cAMP receptor protein from mycobacterium tuberculosis in complex with cAMP and its DNA binding element
Class: transcription/DNA
Keywords: transcription, transcription regulator, camp, camp receptor protein, crp, rv3676, DNA-binding, transcription regulation, transcription-DNA complex
Deposited on 2010-05-12, released 2011-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable transcriptional regulatory protein (probably crp/fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (1-224)
      • expression tag (0)
    Domains in SCOPe 2.08: d3mzha1, d3mzha2, d3mzha3
  • Chain 'B':
    Compound: probable transcriptional regulatory protein (probably crp/fnr-family)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv3676
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69644 (1-224)
      • expression tag (0)
    Domains in SCOPe 2.08: d3mzhb1, d3mzhb2, d3mzhb3
  • Chain 'C':
    Compound: 5'-d(p*ap*ap*ap*tp*gp*tp*gp*ap*tp*cp*tp*ap*gp*gp*tp*cp*ap*cp*gp*tp*g)-3'
  • Chain 'D':
    Compound: 5'-d(p*cp*ap*cp*gp*tp*gp*ap*cp*cp*tp*ap*gp*ap*tp*cp*ap*cp*ap*tp*c)-3'
  • Heterogens: CMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mzhA (A:)
    hmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigr
    rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
    seqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqee
    iaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mzhB (B:)
    hmdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigr
    rapdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpei
    seqllrvlarrlrrtnnnladliftdvpgrvakqllqlaqrfgtqeggalrvthdltqee
    iaqlvgasretvnkaladfahrgwirlegksvlisdserlarrar
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.