| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [232395] (4 PDB entries) |
| Domain d3mzha2: 3mzh A:145-224 [232964] Other proteins in same PDB: d3mzha1, d3mzha3, d3mzhb1, d3mzhb3 automated match to d3r6sd2 protein/DNA complex; complexed with cmp |
PDB Entry: 3mzh (more details), 2.9 Å
SCOPe Domain Sequences for d3mzha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mzha2 a.4.5.0 (A:145-224) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisdserlarrar
Timeline for d3mzha2: