PDB entry 3myy

View 3myy on RCSB PDB site
Description: Structure of E. Coli CheY mutant A113P bound to Beryllium fluoride
Class: signaling protein
Keywords: Chemotaxis, CheA, CheB, CheX, CheZ, two-component signaling, response regulator, SIGNALING PROTEIN
Deposited on 2010-05-11, released 2011-05-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: b1882, cheY, JW1871
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered (111)
  Domains in SCOPe 2.05: d3myya_
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Escherichia coli K-12 [TaxId:83333]
  Gene: b1882, cheY, JW1871
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE67 (0-127)
    • engineered (111)
  Domains in SCOPe 2.05: d3myyb_
• Heterogens: BEF, MN, GOL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3myyA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3myyB (B:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
  nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
  kifeklgm