SCOPe 2.05: Domain d3myyb_: 3myy B:

Lineage for d3myyb_ (3myy B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (17 PDB entries)

8. Domain d3myyb_: 3myy B: [181719]
   automated match to d1a0oa_
   complexed with bef, gol, mn, so4; mutant

Details for d3myyb_

PDB Entry: 3myy, 2.1 Å

PDB Description: structure of e. coli chey mutant a113p bound to beryllium fluoride

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3myyb_:

Sequence; same for both SEQRES and ATOM records:

>d3myyb_ c.23.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwnmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftpatleekln
kifeklgm

Timeline for d3myyb_:

• d3myyb_ first appeared in SCOPe 2.01
  
• d3myyb_ appears in SCOPe 2.04
  
• d3myyb_ appears in SCOPe 2.06
  
• d3myyb_ appears in the current release, SCOPe 2.08