PDB entry 3mvf

View 3mvf on RCSB PDB site
Description: Crystal Structure of Nitrophorin 4 from Rhodnius prolixus Complexed with Nitrite at pH 7.4
Class: transport protein
Keywords: heme, hemoglobin, iron, lipocalin, nitric oxide, nitrite, nitrophorin, TRANSPORT PROTEIN
Deposited on 2010-05-04, released 2010-06-23
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-08-25, with a file datestamp of 2010-08-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.139
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin-4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3mvfa_
  • Heterogens: HEM, NO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mvfA (A:)
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk